Structure of PDB 6jwn Chain C Binding Site BS01

Receptor Information
>6jwn Chain C (length=193) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GLEELLSAPPPDLGAQRRHGWNPKDCSENIEVKEGGLYFERRPVAQSTDG
ARGKRGYSRGLHAWEISWPLEQRGTHAVVGVATALAPLQTDHYAALLGSN
SESWGWDIGRGKLYHQSKGPGAPQYPAGTQGEQLEVPERLLVVLDMEEGT
LGYAIGGTYLGPAFRGLKGRTLYPAVSAVWGQCQVRIRYLGER
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6jwn Crystal structure of SPSB2 in complex with cR9, a cyclic peptide inhibitor of SPSB-iNOS interaction
Resolution1.61 Å
Binding residue
(original residue number in PDB)
R68 P70 V71 A72 G101 T102 Y120 V206 W207 G208
Binding residue
(residue number reindexed from 1)
R41 P43 V44 A45 G74 T75 Y93 V179 W180 G181
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6jwn, PDBe:6jwn, PDBj:6jwn
PDBsum6jwn
PubMed
UniProtQ99619|SPSB2_HUMAN SPRY domain-containing SOCS box protein 2 (Gene Name=SPSB2)

[Back to BioLiP]