Structure of PDB 6jf6 Chain C Binding Site BS01

Receptor Information

>6jf6 Chain C (length=159) Species: 470 (Acinetobacter baumannii)

MSVVLPVAKRGEDILKLIAAPVSANELNSNWLYQLADAMHATMLERNGVG
IAAPQVYISKRVIIVASRPNPRYPDAPEMNAVVMVNPEILEFSSEMCLGE
EGCLSVPDERGQVERAEMVKVKYLTLQGEMVETVFQGFPARIVQHEVDHL
NGILFVERI

Ligand information

>6jf6 Chain E (length=3) Species: 32630 (synthetic construct)

MAS

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6jf6 Met-ala-ser bound crystal structure of class I type b peptide deformylase from Acinetobacter baumannii
• Resolution: 2.35 Å
• Binding residue (original residue number in PDB): N47 G48 V49 G50 N70 R72 E101 G102 R110 H145
• Binding residue (residue number reindexed from 1): N47 G48 V49 G50 N70 R72 E101 G102 R110 H145

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Tue Feb 18 19:12:27 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6jf6', asym_id = 'C', bs = 'BS01', title = 'Met-ala-ser bound crystal structure of class I t... peptide deformylase from Acinetobacter baumannii'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6jf6', asym_id='C', bs='BS01', title='Met-ala-ser bound crystal structure of class I t... peptide deformylase from Acinetobacter baumannii')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0042586', uniprot = '', pdbid = '6jf6', asym_id = 'C'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0042586', uniprot='', pdbid='6jf6', asym_id='C')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>