Structure of PDB 6j8y Chain C Binding Site BS01

Receptor Information

>6j8y Chain C (length=255) Species: 9606 (Homo sapiens)

YSLVASLDNVRNLSTILKAIHFREHATCFATKNGIKVTVENAKCVQANAF
IQAGIFQEFKVQEESVTFRINLTVLLDCLSIFGSSPTLTALRMCYQGYGY
PLMLFLEEGGVVTVCKINTQEPTLDFDFCSTNVINKIILQSEGLREAFSE
LDMTSEVLQITMSPDKPYFRLSTFGNAGSSHLDYPKDSDLMEAFHCNQTQ
VNRYKISLLKPSTKALVLSCKVSIRTDNRGFLSLQYMIRNEDGQICFVEY
YCCPD

Ligand information

>6j8y Chain D (length=10) Species: 9606 (Homo sapiens)

SWVSPDFDTA

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6j8y Structure of the RAD9-RAD1-HUS1 checkpoint clamp bound to RHINO sheds light on the other side of the DNA clamp.
• Resolution: 2.4 Å
• Binding residue (original residue number in PDB): N47 G48 I49 F64 Q66 K155 I157 K240 R244 Q254 M256 F266
• Binding residue (residue number reindexed from 1): N33 G34 I35 F50 Q52 K136 I138 K221 R225 Q235 M237 F247

Enzymatic activity

• Enzyme Commision number: 3.1.11.2: exodeoxyribonuclease III.

Gene Ontology

Molecular Function

• GO:0003684 damaged DNA binding
• GO:0005515 protein binding
• GO:0008311 double-stranded DNA 3'-5' DNA exonuclease activity

Biological Process

• GO:0000077 DNA damage checkpoint signaling
• GO:0006281 DNA repair
• GO:0006974 DNA damage response
• GO:0021762 substantia nigra development
• GO:0051598 meiotic recombination checkpoint signaling
• GO:0071479 cellular response to ionizing radiation

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005694 chromosome
• GO:0030896 checkpoint clamp complex
• GO:0043231 intracellular membrane-bounded organelle

External links

• PDB: RCSB:6j8y, PDBe:6j8y, PDBj:6j8y
• PDBsum: 6j8y
• PubMed: 31776186
• UniProt: O60671|RAD1_HUMAN Cell cycle checkpoint protein RAD1 (Gene Name=RAD1)