Structure of PDB 6j2p Chain C Binding Site BS01

Receptor Information
>6j2p Chain C (length=90) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EDVYCICKRPDYGELMVGCDGCDDWFHFTCLHIPEQFKDLVFSFYCPYCQ
AGITGKGSLPKTLWKRKCRISDCYKPCLQDSKYCSEEHGR
Ligand information
>6j2p Chain H (length=6) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ARTKQT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6j2p Structural basis for histone H3K4me3 recognition by the N-terminal domain of the PHD finger protein Spp1.
Resolution2.85 Å
Binding residue
(original residue number in PDB)		G33 E34 M36 W45
Binding residue
(residue number reindexed from 1)		G13 E14 M16 W25
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0048188 Set1C/COMPASS complex

View graph for
Cellular Component
External links
PDB RCSB:6j2p, PDBe:6j2p, PDBj:6j2p
PDBsum6j2p
PubMed31253666
UniProtQ03012|SPP1_YEAST COMPASS component SPP1 (Gene Name=SPP1)

[Back to BioLiP]