Structure of PDB 6ifr Chain C Binding Site BS01

Receptor Information
>6ifr Chain C (length=121) Species: 767463 (Streptococcus thermophilus ND03) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ILTDENYVDIAEKAILKLERNTRNRKNPDAFFLTTSKLRNLLSLTSTLFD
ESKVKEYDALLDRIAYLRVQFVYQAGREIAVKDLIEKAQILEALKEIKDR
ETLQRFCRYMEALVAYFKFYG
Ligand information
>6ifr Chain J (length=35) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aauggguaauuauagcgagcuagaaagcguuuccg
...................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ifr Structure Studies of the CRISPR-Csm Complex Reveal Mechanism of Co-transcriptional Interference
Resolution3.4 Å
Binding residue
(original residue number in PDB)		T36 T37 S38 K39 R41 Y75 R79
Binding residue
(residue number reindexed from 1)		T34 T35 S36 K37 R39 Y73 R77
External links