Structure of PDB 6i7m Chain C Binding Site BS01

Receptor Information
>6i7m Chain C (length=382) Species: 11320 (Influenza A virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NATEIRASVGKMIDGIGRFYIQMCTELKLSDYEGRLIQNSLTIERMVLSA
FDTGGPIYRRVDGKWRRELILYDKEEIRRIWRQANNGDDATAGLTHMMIW
HSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTM
VMELIRMIKRGINRRTRIAYERMCNILKGKFQTAAQRTMVDQVRESRNPG
NAEFEDLIFLARSALILRGSVAHKSCLPACVYGSAVASGYDFEREGYSLV
GIDPFRLLQNSQVYSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRG
TKVVPRGKLSTRGVQIASNENMETMESSTLELRSRYWAIRTRSGGNTDVS
FQGRGVFELSDEKATSPIVPSFDMSNEGSYFF
Ligand information
>6i7m Chain D (length=19) Species: 11320 (Influenza A virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SSGQISIQPTFSVQRNLPF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6i7m Structural insights into influenza A virus ribonucleoproteins reveal a processive helical track as transcription mechanism.
Resolution10.0 Å
Binding residue
(original residue number in PDB)		R162 S165 L264 I265 R267 H272 S335 F338 E339 D340 R342 I347 A387 I388 R389 T390 S457 F458 Q459 G460 R461 G462 P477 S486 Y487 F489
Binding residue
(residue number reindexed from 1)		R123 S126 L215 I216 R218 H223 S286 F289 E290 D291 R293 I298 A338 I339 R340 T341 S350 F351 Q352 G353 R354 G355 P370 S379 Y380 F382
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005198 structural molecule activity
Biological Process
GO:0039689 negative stranded viral RNA replication
GO:0046718 symbiont entry into host cell
GO:0075732 viral penetration into host nucleus
Cellular Component
GO:0019013 viral nucleocapsid
GO:0019029 helical viral capsid
GO:0042025 host cell nucleus
GO:0043657 host cell
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6i7m, PDBe:6i7m, PDBj:6i7m
PDBsum6i7m
PubMed32152587
UniProtP15682|NCAP_I33A0 Nucleoprotein (Gene Name=NP)

[Back to BioLiP]