Structure of PDB 6hks Chain C Binding Site BS01

Receptor Information
>6hks Chain C (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SYLVLIRITPDEDGKFGFNLKGGVDQKMPLVVSRINPESPADTCIPKLNE
GDQIVLINGRDISEHTHDQVVMFIKASRESHSRELALVIRR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6hks Structural and functional characterization of the PDZ domain of the human phosphatase PTPN3 and its interaction with the human papillomavirus E6 oncoprotein.
Resolution2.19441 Å
Binding residue
(original residue number in PDB)
K520 F521 F523 N524 L525 Q531 S538 H572 D573 I579
Binding residue
(residue number reindexed from 1)
K15 F16 F18 N19 L20 Q26 S33 H67 D68 I74
Enzymatic activity
Enzyme Commision number 3.1.3.48: protein-tyrosine-phosphatase.
External links
PDB RCSB:6hks, PDBe:6hks, PDBj:6hks
PDBsum6hks
PubMed31092861
UniProtP26045|PTN3_HUMAN Tyrosine-protein phosphatase non-receptor type 3 (Gene Name=PTPN3)

[Back to BioLiP]