Structure of PDB 6gfx Chain C Binding Site BS01

Receptor Information
>6gfx Chain C (length=147) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIH
SYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKE
RCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6gfx 3-Fluoro-4-hydroxyprolines: Synthesis, Conformational Analysis, and Stereoselective Recognition by the VHL E3 Ubiquitin Ligase for Targeted Protein Degradation.
Resolution1.83 Å
Binding residue
(original residue number in PDB)		N67 R69 I75 N78 W88 F91 Y98 P99 G104 T105 G106 R107 R108 I109 H110 S111 Y112 H115 W117
Binding residue
(residue number reindexed from 1)		N7 R9 I15 N18 W28 F31 Y38 P39 G44 T45 G46 R47 R48 I49 H50 S51 Y52 H55 W57
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6gfx, PDBe:6gfx, PDBj:6gfx
PDBsum6gfx
PubMed29949369
UniProtP40337|VHL_HUMAN von Hippel-Lindau disease tumor suppressor (Gene Name=VHL)

[Back to BioLiP]