Structure of PDB 6gd3 Chain C Binding Site BS01

Receptor Information
>6gd3 Chain C (length=84) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GAMGWCIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGF
VTMTNYEEAAMAIASLNGYRLGDKILQVSFKTNK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6gd3 HuR biological function involves RRM3-mediated dimerization and RNA binding by all three RRMs.
Resolution1.35 Å
Binding residue
(original residue number in PDB)		F247 Y249 K274 K285 F287 F289 K313 Q316 K320 T321 K323
Binding residue
(residue number reindexed from 1)		F8 Y10 K35 K46 F48 F50 K74 Q77 K81 T82 K84
Binding affinityPDBbind-CN: Kd=155.8uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:6gd3, PDBe:6gd3, PDBj:6gd3
PDBsum6gd3
PubMed30418581
UniProtQ15717|ELAV1_HUMAN ELAV-like protein 1 (Gene Name=ELAVL1)

[Back to BioLiP]