Structure of PDB 6gc5 Chain C Binding Site BS01

Receptor Information
>6gc5 Chain C (length=79) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GWCIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTM
TNYEEAAMAIASLNGYRLGDKILQVSFKT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6gc5 Molecular basis for AU-rich element recognition and dimerization by the HuR C-terminal RRM.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		F247 Y249 K274 K285 F289 Q316 K320 T321
Binding residue
(residue number reindexed from 1)		F5 Y7 K32 K43 F47 Q74 K78 T79
Binding affinityPDBbind-CN: Kd=0.65uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:6gc5, PDBe:6gc5, PDBj:6gc5
PDBsum6gc5
PubMed30718402
UniProtQ15717|ELAV1_HUMAN ELAV-like protein 1 (Gene Name=ELAVL1)

[Back to BioLiP]