Structure of PDB 6gb7 Chain C Binding Site BS01

Receptor Information

>6gb7 Chain C (length=273) Species: 10090 (Mus musculus)

GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAP
WMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSG
CDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQS
GAAEHYKAYLEGECVEWLHRYLKNGLLRTDSPKAHVTHHPRSKGEVTLRC
WALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGK
EQNYTCRVYHEGLPEPLTLRWEP

Ligand information

>6gb7 Chain I (length=7)

FAPGNYP

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6gb7 Successive crystal structure snapshots suggest the basis for MHC class I peptide loading and editing by tapasin.
• Resolution: 2.15 Å
• Binding residue (original residue number in PDB): Y7 E63 K66 Q70 W73 Q97 S150 A152 H155 Y156 Y159 E163 W167 Y171
• Binding residue (residue number reindexed from 1): Y7 E63 K66 Q70 W73 Q97 S150 A152 H155 Y156 Y159 E163 W167 Y171

Gene Ontology

Molecular Function

• GO:0005515 protein binding

Biological Process

• GO:0001913 T cell mediated cytotoxicity
• GO:0001916 positive regulation of T cell mediated cytotoxicity
• GO:0002474 antigen processing and presentation of peptide antigen via MHC class I
• GO:0002485 antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-dependent
• GO:0006955 immune response
• GO:0010977 negative regulation of neuron projection development
• GO:0019882 antigen processing and presentation

Cellular Component

• GO:0005886 plasma membrane
• GO:0009897 external side of plasma membrane
• GO:0016020 membrane
• GO:0030670 phagocytic vesicle membrane
• GO:0042612 MHC class I protein complex
• GO:0098553 lumenal side of endoplasmic reticulum membrane

External links

• PDB: RCSB:6gb7, PDBe:6gb7, PDBj:6gb7
• PDBsum: 6gb7
• PubMed: 30808808
• UniProt: P01899|HA11_MOUSE H-2 class I histocompatibility antigen, D-B alpha chain (Gene Name=H2-D1)