Structure of PDB 6fuw Chain C Binding Site BS01

Receptor Information
>6fuw Chain C (length=114) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMKSGAAVCEFFLKAACGK
GGMCPFRHISGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSK
FGECSNKECPFLHI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6fuw Structural basis of AAUAAA polyadenylation signal recognition by the human CPSF complex.
Resolution3.07 Å
Binding residue
(original residue number in PDB)		K69 H70 R73 K77 K78 F84 F98 S106 N107 F112
Binding residue
(residue number reindexed from 1)		K68 H69 R72 K76 K77 F83 F97 S105 N106 F111
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0046872 metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:6fuw, PDBe:6fuw, PDBj:6fuw
PDBsum6fuw
PubMed29358758
UniProtO95639|CPSF4_HUMAN Cleavage and polyadenylation specificity factor subunit 4 (Gene Name=CPSF4)

[Back to BioLiP]