Structure of PDB 6fkp Chain C Binding Site BS01

Receptor Information
>6fkp Chain C (length=52) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCTVCLA
QQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6fkp Targeting Ligandable Pockets on Plant Homeodomain (PHD) Zinc Finger Domains by a Fragment-Based Approach.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		V1677 D1688 E1689 L1691 L1693 V1713 P1714 E1715 G1716
Binding residue
(residue number reindexed from 1)		V2 D13 E14 L16 L18 V38 P39 E40 G41
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6fkp, PDBe:6fkp, PDBj:6fkp
PDBsum6fkp
PubMed29529862
UniProtQ9UIF9|BAZ2A_HUMAN Bromodomain adjacent to zinc finger domain protein 2A (Gene Name=BAZ2A)

[Back to BioLiP]