Structure of PDB 6f8g Chain C Binding Site BS01

Receptor Information
>6f8g Chain C (length=142) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MASGKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNP
KGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAY
RFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6f8g The Structure of the SPOP-Pdx1 Interface Reveals Insights into the Phosphorylation-Dependent Binding Regulation.
Resolution2.03 Å
Binding residue
(original residue number in PDB)
Y83 Y87 K115 M117 Y123 K129 D130 W131 G132 F133 K135 F136 I137 R138
Binding residue
(residue number reindexed from 1)
Y60 Y64 K92 M94 Y100 K106 D107 W108 G109 F110 K112 F113 I114 R115
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6f8g, PDBe:6f8g, PDBj:6f8g
PDBsum6f8g
PubMed30449689
UniProtO43791|SPOP_HUMAN Speckle-type POZ protein (Gene Name=SPOP)

[Back to BioLiP]