Structure of PDB 6e4p Chain C Binding Site BS01

Receptor Information

>6e4p Chain C (length=68) Species: 5691 (Trypanosoma brucei) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MRVQVSGLSDETTWHTLKDHLRQAGEVTFCKVFSGGRAVVEFVTPEDAAR
AITELQASELEGATLFLR

Ligand information

>6e4p Chain J (length=3) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

uuu

...

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6e4p The RRM of the kRNA-editing protein TbRGG2 uses multiple surfaces to bind and remodel RNA.
Resolution	1.949 Å
Binding residue (original residue number in PDB)	Q224 T254 E255 L256 S259 E260
Binding residue (residue number reindexed from 1)	Q23 T53 E54 L55 S58 E59

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding

View graph for
Molecular Function

External links

PDB	RCSB:6e4p, PDBe:6e4p, PDBj:6e4p
PDBsum	6e4p
PubMed	30544166
UniProt	Q389P7

[Back to BioLiP]