Structure of PDB 6drt Chain C Binding Site BS01

Receptor Information

>6drt Chain C (length=230) Species: 10665 (Tequatrovirus T4) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MKLSKDTTALLKNFATINSGIMLKSGQFIMTRAVNGTTYAEANISDVIDF
DVAIYDLNGFLGILSLVNDDAEISQSEDGNIKIADARSTIFWPAADPSTV
VAPNKPIPFPVASAVTEIKAEDLQQLLRVSRGLQIDTIAITVKEGKIVIN
GFNKVEDSALTRVKYSLTLGDYDGENTFNFIINMANMKMQPGNYKLLLWA
KGKQGAAKFEGEHANYVVALEADSTHDFLE

Ligand information

>6drt Chain F (length=9) Species: 10665 (Tequatrovirus T4) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

EGLDFLFDA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6drt T4 DNA ligase structure reveals a prototypical ATP-dependent ligase with a unique mode of sliding clamp interaction.
Resolution	2.117 Å
Binding residue (original residue number in PDB)	R1032 G1036 Y1039 K1105 I1107 Q1204 V1217 A1219
Binding residue (residue number reindexed from 1)	R32 G36 Y39 K105 I107 Q204 V217 A219

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0030337	DNA polymerase processivity factor activity

	Biological Process
GO:0006260	DNA replication
GO:0019083	viral transcription
GO:0039686	bidirectional double-stranded viral DNA replication
GO:0039693	viral DNA genome replication

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:6drt, PDBe:6drt, PDBj:6drt
PDBsum	6drt
PubMed	30169742
UniProt	P04525\|CLAMP_BPT4 Sliding clamp (Gene Name=45)

[Back to BioLiP]