Structure of PDB 6dn7 Chain C Binding Site BS01

Receptor Information
>6dn7 Chain C (length=189) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RLDQLLDMPAAGLAVQLRHAWNPEDRSLNVFVKDDDRLTFHRHPVAQSTD
GIRGKVGHARGLHAWQINWPARQRGTHAVVGVATARAPLHSVGYTALVGS
DAESWGWDLGRSRLYHDGKNQPGVAYPALPDSLLVVLDMDEGTLSFIVDG
QYLGVAFRGLKGKKLYPVVSAVWGHCEVTMRYINGLDPE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6dn7 A Cyclic Peptide Inhibitor of the iNOS-SPSB Protein-Protein Interaction as a Potential Anti-Infective Agent.
Resolution1.4 Å
Binding residue
(original residue number in PDB)
R73 P75 V76 A77 G106 T107 Y125 V212 W213 G214
Binding residue
(residue number reindexed from 1)
R42 P44 V45 A46 G75 T76 Y94 V172 W173 G174
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6dn7, PDBe:6dn7, PDBj:6dn7
PDBsum6dn7
PubMed30226743
UniProtQ96A44|SPSB4_HUMAN SPRY domain-containing SOCS box protein 4 (Gene Name=SPSB4)

[Back to BioLiP]