Structure of PDB 6dfy Chain C Binding Site BS01

Receptor Information
>6dfy Chain C (length=54) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RTAVTGSQTALLLRAFEKDRFPGIAAREELARETGLPESRIQIWFQNRRA
RHPG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6dfy Comment on structural basis of DUX4/IGH-driven transactivation.
Resolution2.623 Å
Binding residue
(original residue number in PDB)		R48 I51 N55 R59
Binding residue
(residue number reindexed from 1)		R40 I43 N47 R51
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6dfy, PDBe:6dfy, PDBj:6dfy
PDBsum6dfy
PubMed30054554
UniProtQ9UBX2|DUX4_HUMAN Double homeobox protein 4 (Gene Name=DUX4)

[Back to BioLiP]