Structure of PDB 6d6q Chain C Binding Site BS01

Receptor Information
>6d6q Chain C (length=265) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTV
ICGVKAEFAAPSTDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQF
IADVIENSQIIQKEDLCISPGKLVWVLYCDLICLDYDGNILDACTFALLA
ALKNVQLPEVTINEETALAEVNLKKKSYLNIRTHPVATSFAVFDDTLLIV
DPTGEEEHLATGTLTIVMDEEGKLCCLHKPGGSGLTGAKLQDCMSRAVTR
HKEVKKLMDEVIKSM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6d6q Helicase-Dependent RNA Decay Illuminated by a Cryo-EM Structure of a Human Nuclear RNA Exosome-MTR4 Complex.
Resolution3.45 Å
Binding residue
(original residue number in PDB)		S41 L50
Binding residue
(residue number reindexed from 1)		S33 L42
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004532 RNA exonuclease activity
GO:0005515 protein binding
GO:0035925 mRNA 3'-UTR AU-rich region binding
GO:0042802 identical protein binding
Biological Process
GO:0000288 nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
GO:0000467 exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000956 nuclear-transcribed mRNA catabolic process
GO:0006364 rRNA processing
GO:0006396 RNA processing
GO:0006401 RNA catabolic process
GO:0034473 U1 snRNA 3'-end processing
GO:0034475 U4 snRNA 3'-end processing
GO:0034476 U5 snRNA 3'-end processing
GO:0071028 nuclear mRNA surveillance
GO:0071035 nuclear polyadenylation-dependent rRNA catabolic process
GO:0071038 TRAMP-dependent tRNA surveillance pathway
Cellular Component
GO:0000176 nuclear exosome (RNase complex)
GO:0000177 cytoplasmic exosome (RNase complex)
GO:0000178 exosome (RNase complex)
GO:0001650 fibrillar center
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0043231 intracellular membrane-bounded organelle
GO:0101019 nucleolar exosome (RNase complex)
GO:1902494 catalytic complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6d6q, PDBe:6d6q, PDBj:6d6q
PDBsum6d6q
PubMed29906447
UniProtQ96B26|EXOS8_HUMAN Exosome complex component RRP43 (Gene Name=EXOSC8)

[Back to BioLiP]