Structure of PDB 6d11 Chain C Binding Site BS01

Receptor Information
>6d11 Chain C (length=221) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLLESGGGMVQPGGSLRLSCTASGFSFSNYGMSWVRQAPGKGPEWVSG
ISGSSGDTYYADSVKGRFTISRDNSKNTVNLQMNSLRAEDTAVYYCAKEG
GFCSSATCYYYFDCWGQGTLVTVSSASTKGPSVFPLAPSSGTAALGCLVK
DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQT
YICNVNHKPSNTKVDKRVEPK
Ligand information
>6d11 Chain E (length=19) Species: 5833 (Plasmodium falciparum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NANPNANPNANPNANPNAN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6d11 Antihomotypic affinity maturation improves human B cell responses against a repetitive epitope.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		D56 T57 Y58 G96 F98 S100 S100A C100D Y100E
Binding residue
(residue number reindexed from 1)		D57 T58 Y59 G100 F102 S104 S105 C108 Y109
External links