Structure of PDB 6d01 Chain C Binding Site BS01

Receptor Information
>6d01 Chain C (length=220) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVESGGGVVQPGRSLRLSCAASGFTFSNYGMHWVRQAPGKGLEWVAV
IWYDGSKKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARVR
DSSDYYGDAFDIWGQGTMVTVSSASTKGPSVFPLAPSSGTAALGCLVKDY
FPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYI
CNVNHKPSNTKVDKRVEPKS
Ligand information
>6d01 Chain I (length=19) Species: 5833 (Plasmodium falciparum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ANPNANPNANPNANPNANP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6d01 Antihomotypic affinity maturation improves human B cell responses against a repetitive epitope.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		N31 Y32 W52 Y52A Y58 D97 S98 S99 D100 Y100A Y100B G100C
Binding residue
(residue number reindexed from 1)		N31 Y32 W52 Y53 Y59 D101 S102 S103 D104 Y105 Y106 G107
External links