Structure of PDB 6chg Chain C Binding Site BS01

Receptor Information
>6chg Chain C (length=143) Species: 284590 (Kluyveromyces lactis NRRL Y-1140) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LSLNQLTKRKKPVTFARSAIHNWGLYALEPIAAKEMIIEYVGESIRQPVA
EMREKRYIKSGIGSSYLFRIDENTVIDATKRGGIARFINHCCEPSCTAKI
IKVDGRKRIVIYALRDIGTNEELTYDYKFPCLCGAPSCKGFLN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6chg Crystal Structure of the COMPASS H3K4 Methyltransferase Catalytic Module.
Resolution2.985 Å
Binding residue
(original residue number in PDB)		L914 F915 R916 Y972 Y974 F976
Binding residue
(residue number reindexed from 1)		L67 F68 R69 Y125 Y127 F129
Enzymatic activity
Enzyme Commision number 2.1.1.354: [histone H3]-lysine(4) N-trimethyltransferase.
Gene Ontology
Molecular Function
GO:0042800 histone H3K4 methyltransferase activity

View graph for
Molecular Function
External links
PDB RCSB:6chg, PDBe:6chg, PDBj:6chg
PDBsum6chg
PubMed30100181
UniProtQ6CIT4|SET1_KLULA Histone-lysine N-methyltransferase, H3 lysine-4 specific (Gene Name=SET1)

[Back to BioLiP]