Structure of PDB 6byk Chain C Binding Site BS01

Receptor Information
>6byk Chain C (length=230) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKN
VVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLEL
LDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQ
EAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAI
AELDTLNEESYKDSTLIMQLLRDNLTLWTS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6byk Structural basis of O-GlcNAc recognition by mammalian 14-3-3 proteins.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		N44 L174 I219 L222 N226
Binding residue
(residue number reindexed from 1)		N42 L172 I217 L220 N224
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004860 protein kinase inhibitor activity
GO:0005515 protein binding
GO:0019899 enzyme binding
GO:0019904 protein domain specific binding
GO:0042802 identical protein binding
GO:0042826 histone deacetylase binding
GO:0045296 cadherin binding
GO:0050815 phosphoserine residue binding
GO:0051219 phosphoprotein binding
Biological Process
GO:0006605 protein targeting
GO:0007165 signal transduction
GO:0008104 protein localization
GO:0043085 positive regulation of catalytic activity
GO:0045744 negative regulation of G protein-coupled receptor signaling pathway
GO:0051220 cytoplasmic sequestering of protein
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005773 vacuole
GO:0005774 vacuolar membrane
GO:0005829 cytosol
GO:0005925 focal adhesion
GO:0016020 membrane
GO:0042470 melanosome
GO:0048471 perinuclear region of cytoplasm
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6byk, PDBe:6byk, PDBj:6byk
PDBsum6byk
PubMed29784830
UniProtP31946|1433B_HUMAN 14-3-3 protein beta/alpha (Gene Name=YWHAB)

[Back to BioLiP]