Structure of PDB 6a5e Chain C Binding Site BS01

Receptor Information
>6a5e Chain C (length=84) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TTCKEDFANKNYTIITSRCKGPNYPANVCCSAFKDFACPFAEVLNDEKND
CASTMFSYINLYGRYPPGIFANMCKEGKEGLDCT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6a5e Mechanisms of RALF peptide perception by a heterotypic receptor complex.
Resolution2.766 Å
Binding residue
(original residue number in PDB)		F74 A78 C79 E83 N86 E88 F97 P108 G109 F111 A112 G118 E120 G121 L122 D123 C124
Binding residue
(residue number reindexed from 1)		F33 A37 C38 E42 N45 E47 F56 P67 G68 F70 A71 G77 E79 G80 L81 D82 C83
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6a5e, PDBe:6a5e, PDBj:6a5e
PDBsum6a5e
PubMed31291642
UniProtQ6NLF4|LLG2_ARATH GPI-anchored protein LLG2 (Gene Name=LLG2)

[Back to BioLiP]