Structure of PDB 5zyt Chain C Binding Site BS01

Receptor Information
>5zyt Chain C (length=220) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RVPQNWFPIFNPEPLKIPLQRNVIPSVTRVLQQTMTKQQVFLLERWKQRM
ILELGEDGFKEYTSNVFLQGKRFHEALESILSPQENLLKSGYIESVQHIL
KDVSGVRALESAVQHETLNYIGLLDCVAEYQGKLCVIDWKTSEKPKPFIQ
STFDNPLQVVAYMGAMNHDTNYSFQVQCGLIVVAYKDGSPAHPHFMDAEL
CSQYWTKWLLRLEEYTEKKK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5zyt Structural insights into DNA degradation by human mitochondrial nuclease MGME1
Resolution2.702 Å
Binding residue
(original residue number in PDB)		S132 T134 Q145 L149 W152 F173 K177 G235 L236 K253 T254 S255 P258 P260 F261 F266 Y275 H305
Binding residue
(residue number reindexed from 1)		S26 T28 Q39 L43 W46 F67 K71 G122 L123 K140 T141 S142 P145 P147 F148 F153 Y162 H192
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004527 exonuclease activity
GO:0005515 protein binding
GO:0008297 single-stranded DNA exodeoxyribonuclease activity
GO:0045145 single-stranded DNA 5'-3' DNA exonuclease activity
Biological Process
GO:0000002 mitochondrial genome maintenance
GO:0006264 mitochondrial DNA replication
GO:0006281 DNA repair
GO:0043504 mitochondrial DNA repair
Cellular Component
GO:0005739 mitochondrion

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5zyt, PDBe:5zyt, PDBj:5zyt
PDBsum5zyt
PubMed30247721
UniProtQ9BQP7|MGME1_HUMAN Mitochondrial genome maintenance exonuclease 1 (Gene Name=MGME1)

[Back to BioLiP]