Structure of PDB 5zmd Chain C Binding Site BS01

Receptor Information
>5zmd Chain C (length=395) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EFYQQWQLKYPKLILREASSVSEELHKEVQEAFLTLHKHGCLFRDLVRIK
GKDLLTPVSRILIGNPGCTYKYLNTRLFTVPWPVKNIKHTEAEIAAACET
FLKLNDYLQIETIQALEELAADEVDIKSRAAYNVTLLNFMDPQKMPYLKE
EPYFGMGKMAVSWHHDENLVDRSAVAVYSYSCDIWHVGFKISWDIETPGL
AIPLHQGDCYFMLDDLNATHKHCVLAGSQPRFSSTHRVAECSTGTLDYIL
QRCQLALQNSLKSFEPAVLKQGEEIHNEVEFEWLRQFWFQGNRYRKCTDW
WCQPMAQLEALWKKMEGVTNAVLHEVRNEILTAILASLTARQNLRREWHA
RCQSRIARTLPADQKPECRPYWEKDDASMPLPFDLTDIVSELRGQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5zmd Structural insights into FTO's catalytic mechanism for the demethylation of multiple RNA substrates.
Resolution3.3 Å
Binding residue
(original residue number in PDB)
K88 S277 W278 K306
Binding residue
(residue number reindexed from 1)
K52 S192 W193 K221
Binding affinityPDBbind-CN: Kd=3.69uM
Enzymatic activity
Enzyme Commision number 1.14.11.-
1.14.11.53: mRNA N(6)-methyladenine demethylase.
Gene Ontology
Molecular Function
GO:0008198 ferrous iron binding
GO:0016706 2-oxoglutarate-dependent dioxygenase activity
GO:0016740 transferase activity
GO:0035515 oxidative RNA demethylase activity
GO:0035516 broad specificity oxidative DNA demethylase activity
GO:0046872 metal ion binding
GO:0051213 dioxygenase activity
GO:1990931 mRNA N6-methyladenosine dioxygenase activity
GO:1990984 tRNA demethylase activity
Biological Process
GO:0001659 temperature homeostasis
GO:0006307 DNA alkylation repair
GO:0010883 regulation of lipid storage
GO:0016180 snRNA processing
GO:0040014 regulation of multicellular organism growth
GO:0042245 RNA repair
GO:0044065 regulation of respiratory system process
GO:0060612 adipose tissue development
GO:0061157 mRNA destabilization
GO:0070350 regulation of white fat cell proliferation
GO:0090335 regulation of brown fat cell differentiation
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0016607 nuclear speck
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5zmd, PDBe:5zmd, PDBj:5zmd
PDBsum5zmd
PubMed30718435
UniProtQ9C0B1|FTO_HUMAN Alpha-ketoglutarate-dependent dioxygenase FTO (Gene Name=FTO)

[Back to BioLiP]