Structure of PDB 5zko Chain C Binding Site BS01

Receptor Information
>5zko Chain C (length=53) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KREVRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKD
LYC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5zko Structural Insights into the CRTC2-CREB Complex Assembly on CRE.
Resolution3.05 Å
Binding residue
(original residue number in PDB)		N293 R294 R301
Binding residue
(residue number reindexed from 1)		N9 R10 R17
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5zko, PDBe:5zko, PDBj:5zko
PDBsum5zko
PubMed29733854
UniProtP16220|CREB1_HUMAN Cyclic AMP-responsive element-binding protein 1 (Gene Name=CREB1)

[Back to BioLiP]