Structure of PDB 5zgc Chain C Binding Site BS01

Receptor Information

>5zgc Chain C (length=262) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRQYDLPYPEAIFEL
PFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDG
LERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPV
CTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTE
AVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEE
MRDLVQRETGKL

Ligand information

>5zgc Chain I (length=7) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GGAKRHR

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5zgc Crystal Structure of SIRT3 in complex with H4K16bhb peptide
Resolution	2.9 Å
Binding residue (original residue number in PDB)	F180 Q228 I230 H248 V292 F293 F294 G295 E296 V324 E325 W353
Binding residue (residue number reindexed from 1)	F48 Q96 I98 H116 V160 F161 F162 G163 E164 V192 E193 W221

Enzymatic activity

Catalytic site (original residue number in PDB)	P155 D156 F157 R158 N229 D231 H248
Catalytic site (residue number reindexed from 1)	P34 D35 F36 R37 N97 D99 H116
Enzyme Commision number	2.3.1.286: protein acetyllysine N-acetyltransferase.

Gene Ontology

	Molecular Function
GO:0017136	NAD-dependent histone deacetylase activity
GO:0051287	NAD binding
GO:0070403	NAD+ binding

View graph for
Molecular Function

External links

PDB	RCSB:5zgc, PDBe:5zgc, PDBj:5zgc
PDBsum	5zgc
PubMed
UniProt	Q9NTG7\|SIR3_HUMAN NAD-dependent protein deacetylase sirtuin-3, mitochondrial (Gene Name=SIRT3)

[Back to BioLiP]