Structure of PDB 5z8n Chain C Binding Site BS01

Receptor Information
>5z8n Chain C (length=183) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRKELDSYTIKGTNKVVRAGDCVLMRPSDAGKPPYVARVEKIEADARNNV
KVHCRWYYRPEESLGGRRQFHGAKELFLSDHFDVQSAHTIEGKCIVHTFK
NYTRLENVGAEDYYCRFEYKAATGAFTPDRVAVYCKCEMPYNPDDLMVQC
EGCKDWYHPACVGMTIEEAKKLDHFVCAECSSD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5z8n EBS is a bivalent histone reader that regulates floral phase transition in Arabidopsis.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		T117 N121 Y155 P157 L160 M161 V162 Q163 W170 L186
Binding residue
(residue number reindexed from 1)		T103 N107 Y141 P143 L146 M147 V148 Q149 W156 L172
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003682 chromatin binding

View graph for
Molecular Function
External links
PDB RCSB:5z8n, PDBe:5z8n, PDBj:5z8n
PDBsum5z8n
PubMed30082787
UniProtF4JL28|EBS_ARATH Chromatin remodeling protein EBS (Gene Name=EBS)

[Back to BioLiP]