Structure of PDB 5z2t Chain C Binding Site BS01

Receptor Information
>5z2t Chain C (length=53) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RTAVTGSQTALLLRAFEKDRFPGIAAREELARETGLPESRIQIWFQNRRA
RHP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5z2t Structural basis of DUX4/IGH-driven transactivation.
Resolution2.623 Å
Binding residue
(original residue number in PDB)		V12 R48 I51 N55 R59
Binding residue
(residue number reindexed from 1)		V4 R40 I43 N47 R51
Binding affinityPDBbind-CN: Kd=7.2uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:5z2t, PDBe:5z2t, PDBj:5z2t
PDBsum5z2t
PubMed29572508
UniProtQ9UBX2|DUX4_HUMAN Double homeobox protein 4 (Gene Name=DUX4)

[Back to BioLiP]