Structure of PDB 5z12 Chain C Binding Site BS01

Receptor Information

>5z12 Chain C (length=203) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ERILEAELAVEPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLR
AGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTE
LVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEA
YCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLM
EML

Ligand information

>5z12 Chain F (length=9) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

HKILHRLLQ

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5z12 Structural insights into the heterodimeric complex of the nuclear receptors FXR and RXR
Resolution	2.75 Å
Binding residue (original residue number in PDB)	V280 Q297 R302 F450 E453
Binding residue (residue number reindexed from 1)	V28 Q45 R50 F198 E201

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003707	nuclear steroid receptor activity
GO:0008270	zinc ion binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5z12, PDBe:5z12, PDBj:5z12
PDBsum	5z12
PubMed	29934308
UniProt	P19793\|RXRA_HUMAN Retinoic acid receptor RXR-alpha (Gene Name=RXRA)

[Back to BioLiP]