Structure of PDB 5z00 Chain C Binding Site BS01

Receptor Information
>5z00 Chain C (length=111) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LNLNIVPLFEKTLSASDAGRIGRLVLPKACAEAYFPPISQSEGIPLKIQD
VRGREWTFQFRYWPNNNSRMYVLEGVTPCIQSMMLQAGDTVTFSRVDPGG
KLIMGSRKAAN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5z00 Structural insight into the role of VAL1 B3 domain for targeting to FLC locus in Arabidopsis thaliana.
Resolution2.587 Å
Binding residue
(original residue number in PDB)		R306 R309 R347 W349 N351 M356
Binding residue
(residue number reindexed from 1)		R20 R23 R61 W63 N65 M70
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:5z00, PDBe:5z00, PDBj:5z00
PDBsum5z00
PubMed29733847
UniProtQ8W4L5|VAL1_ARATH B3 domain-containing transcription repressor VAL1 (Gene Name=VAL1)

[Back to BioLiP]