Structure of PDB 5yzy Chain C Binding Site BS01

Receptor Information
>5yzy Chain C (length=111) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LNLNIVPLFEKTLSASDAGRIGRLVLPKACAEAYFPPISQSEGIPLKIQD
VRGREWTFQFRYWPNNNSRMYVLEGVTPCIQSMMLQAGDTVTFSRVDPGG
KLIMGSRKAAN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5yzy Structural insight into the role of VAL1 B3 domain for targeting to FLC locus in Arabidopsis thaliana.
Resolution2.61 Å
Binding residue
(original residue number in PDB)		R309 W349 N351
Binding residue
(residue number reindexed from 1)		R23 W63 N65
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:5yzy, PDBe:5yzy, PDBj:5yzy
PDBsum5yzy
PubMed29733847
UniProtQ8W4L5|VAL1_ARATH B3 domain-containing transcription repressor VAL1 (Gene Name=VAL1)

[Back to BioLiP]