Structure of PDB 5yxl Chain C Binding Site BS01

Receptor Information
>5yxl Chain C (length=210) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TPDQQTLLHFIMDSYNKQRMPQEITNKILKEEFSAEENFLILTEMATNHV
QVLVEFTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNSDLLEERI
RNSGISDEYITPMFSFYKSIGELKMTQEEYALLTAIVILSPDRQYIKDRE
AVEKLQEPLLDVLQKLCKIHQPENPQHFACLLGRLTELRTFNHHHAEMLF
TPLLCEIWDV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5yxl A ligand M binding to FXR
Resolution2.24 Å
Binding residue
(original residue number in PDB)		V56 K60 H70 L221
Binding residue
(residue number reindexed from 1)		V54 K58 H68 L203
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004879 nuclear receptor activity
GO:0032052 bile acid binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0038183 bile acid signaling pathway

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5yxl, PDBe:5yxl, PDBj:5yxl
PDBsum5yxl
PubMed
UniProtQ96RI1|NR1H4_HUMAN Bile acid receptor (Gene Name=NR1H4)

[Back to BioLiP]