Structure of PDB 5yqg Chain C Binding Site BS01

Receptor Information
>5yqg Chain C (length=237) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FMGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAY
KNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCND
VLALLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEA
SEAAYKEAFEISKEHMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQ
AFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5yqg Structural determinants controlling 14-3-3 recruitment to the endocytic adaptor Numb and dissociation of the Numb/alpha-adaptin complex.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		R57 R132 Y133 L177 N178 V181 N229
Binding residue
(residue number reindexed from 1)		R58 R133 Y134 L178 N179 V182 N230
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003779 actin binding
GO:0005515 protein binding
GO:0017080 sodium channel regulator activity
GO:0019899 enzyme binding
GO:0019904 protein domain specific binding
GO:0035259 nuclear glucocorticoid receptor binding
GO:0042802 identical protein binding
GO:0044325 transmembrane transporter binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0002028 regulation of sodium ion transport
GO:0006713 glucocorticoid catabolic process
GO:0006886 intracellular protein transport
GO:0007010 cytoskeleton organization
GO:0007088 regulation of mitotic nuclear division
GO:0042921 nuclear receptor-mediated glucocorticoid signaling pathway
GO:0043066 negative regulation of apoptotic process
GO:0045184 establishment of protein localization
GO:0045893 positive regulation of DNA-templated transcription
GO:0050774 negative regulation of dendrite morphogenesis
GO:0086010 membrane depolarization during action potential
GO:0099171 presynaptic modulation of chemical synaptic transmission
GO:2000649 regulation of sodium ion transmembrane transporter activity
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0014704 intercalated disc
GO:0098793 presynapse
GO:0098978 glutamatergic synapse
GO:0150048 cerebellar granule cell to Purkinje cell synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5yqg, PDBe:5yqg, PDBj:5yqg
PDBsum5yqg
PubMed29382713
UniProtP68510|1433F_MOUSE 14-3-3 protein eta (Gene Name=Ywhah)

[Back to BioLiP]