Structure of PDB 5yiw Chain C Binding Site BS01

Receptor Information
>5yiw Chain C (length=45) Species: 565050 (Caulobacter vibrioides NA1000) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSWTDERVSTLKKLWLDGLSASQIAKQLGGVTRNAVIGKVHRLGL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5yiw Structural insights into the unique mechanism of transcription activation by Caulobacter crescentus GcrA.
Resolution1.551 Å
Binding residue
(original residue number in PDB)		A25 K26 G29 G30 V31 T32 R33
Binding residue
(residue number reindexed from 1)		A25 K26 G29 G30 V31 T32 R33
Enzymatic activity
Enzyme Commision number ?
External links