Structure of PDB 5yi7 Chain C Binding Site BS01

Receptor Information
>5yi7 Chain C (length=131) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
WQADEEAVRSATCSFSVKYLGCVEVFESRGMQVCEEALKVLRQSRPVRGL
LHVSGDGLRVVDDETKGLIVDQTIEKVSFCAPDRNHERGFSYICRDGTTR
RWMCHGFLACKDSGERLSHAVGCAFAVCLER
Ligand information
>5yi7 Chain D (length=17) Species: 7227 (Drosophila melanogaster) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NPFEVLRQACFENPGLN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5yi7 Basal condensation of Numb and Pon complex via phase transition during Drosophila neuroblast asymmetric division.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		R97 E145 V147 S148 F149 C150 P152 S188 F195
Binding residue
(residue number reindexed from 1)		R29 E75 V77 S78 F79 C80 P82 S118 F125
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5yi7, PDBe:5yi7, PDBj:5yi7
PDBsum5yi7
PubMed29467404
UniProtP16554|NUMB_DROME Protein numb (Gene Name=numb)

[Back to BioLiP]