Structure of PDB 5yej Chain C Binding Site BS01

Receptor Information

>5yej Chain C (length=169) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QLHKPDVVAAATKILDDHGIADLTMRRLARELDVTPGALYWHFANKQELL
GAVADHILRTARTDTADLAWREQIHESCRALRDALLSHTDGAELVSASFA
SGQSVVITEIVEQLGRAARAAGVSDADVDAAARTVIYYVLGFTVDEQSRL
QWRQFRFGLQLLVDGLAAH

Ligand information

>5yej Chain D (length=19) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

acctgaacaccgttcaagt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5yej Structural insights into operator recognition by BioQ in the Mycobacterium smegmatis biotin synthesis pathway.
Resolution	2.698 Å
Binding residue (original residue number in PDB)	Q2 L3 V35 T36 W42
Binding residue (residue number reindexed from 1)	Q1 L2 V34 T35 W41
Binding affinity	PDBbind-CN: Kd=13.8nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000976	transcription cis-regulatory region binding
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity
GO:0046872	metal ion binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0045892	negative regulation of DNA-templated transcription
GO:0046677	response to antibiotic

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5yej, PDBe:5yej, PDBj:5yej
PDBsum	5yej
PubMed	29852200
UniProt	A0QX69

[Back to BioLiP]