Structure of PDB 5yd5 Chain C Binding Site BS01

Receptor Information
>5yd5 Chain C (length=240) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLQQSGAELVRPGTSVKMSCKAAGYTFTKYWIGWVKQRPGHGLEWIGD
IHPGSFYSNYNEKFKGKATLTADTSSSTAYMQLSSLTSEDSAIYYCARDY
YTNYGDWGQGTSVTVSSAGGGGSGGGGSDIVMTQAAPSVSVTPGESVSIS
CRSSKSLLHRNGNTYLFWFLQRPGQSPQLLIYRMSNLASGVPDRFSGSGS
GTAFTLRISRVEAEDVGVYYCMQHLEYPYTFGSGTKLELK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5yd5 Intramolecular H-bonds govern the recognition of a flexible peptide by an antibody
Resolution1.96 Å
Binding residue
(original residue number in PDB)		S210 T217 R219
Binding residue
(residue number reindexed from 1)		S198 T205 R207
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003823 antigen binding
Biological Process
GO:0002250 adaptive immune response
GO:0006955 immune response
Cellular Component
GO:0005615 extracellular space
GO:0019814 immunoglobulin complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5yd5, PDBe:5yd5, PDBj:5yd5
PDBsum5yd5
PubMed29924367
UniProtP01630|KV2A6_MOUSE Ig kappa chain V-II region 7S34.1

[Back to BioLiP]