Structure of PDB 5yba Chain C Binding Site BS01

Receptor Information
>5yba Chain C (length=175) Species: 5722 (Trichomonas vaginalis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSMLKRPKTFFDISIRGDKVGKIVFELFNDIVPKTAENFRALCTGEKGIG
KSGMPLSYKGTMFHRIIPQFMIQGGDFTRFNGTGGESIYGMKFDDENFKV
KHDKPGLLSMANAGPNTNGSQFFITTVETPWLDGHHCVFGQVIEGMDIVK
QIESCGTESGRPRAMCMVTDCGEMK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5yba Structural basis of interaction between dimeric cyclophilin 1 and Myb1 transcription factor in Trichomonas vaginalis
Resolution2.062 Å
Binding residue
(original residue number in PDB)		R63 F68 Q71 A109 N110 A111 Q119 F121 L130 H134
Binding residue
(residue number reindexed from 1)		R65 F70 Q73 A111 N112 A113 Q121 F123 L132 H136
Enzymatic activity
Catalytic site (original residue number in PDB) R63 F68 Q71 N110 F121 L130 H134
Catalytic site (residue number reindexed from 1) R65 F70 Q73 N112 F123 L132 H136
Enzyme Commision number 5.2.1.8: peptidylprolyl isomerase.
Gene Ontology
Molecular Function
GO:0003755 peptidyl-prolyl cis-trans isomerase activity
GO:0016018 cyclosporin A binding
Biological Process
GO:0000413 protein peptidyl-prolyl isomerization
GO:0006457 protein folding
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5yba, PDBe:5yba, PDBj:5yba
PDBsum5yba
PubMed29615721
UniProtA2DT06

[Back to BioLiP]