Structure of PDB 5xt6 Chain C Binding Site BS01

Receptor Information

>5xt6 Chain C (length=135) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168)

NLDTLYRQVIMDHYKNPRNKGVLNDSIVVDMNNPTCGDRIRLTMKLDGDI
VEDAKFEGEGCSISMASASMMTQAIKGKDIETALSMSKIFSDMMQGKEYD
DSIDLGDIEALQGVSKFPARIKCATLSWKALEKGV

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 5xt6 Chain C Residue 201

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5xt6 Zinc-Ligand Swapping Mediated Complex Formation and Sulfur Transfer between SufS and SufU for Iron-Sulfur Cluster Biogenesis in Bacillus subtilis
• Resolution: 3.5 Å
• Binding residue (original residue number in PDB): D43 C66 C128
• Binding residue (residue number reindexed from 1): D38 C61 C123
• Annotation score: 4

Enzymatic activity

• Enzyme Commision number: 2.-.-.-

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0005515 protein binding
• GO:0008198 ferrous iron binding
• GO:0016740 transferase activity
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051537 2 iron, 2 sulfur cluster binding

Biological Process

• GO:0006879 intracellular iron ion homeostasis
• GO:0016226 iron-sulfur cluster assembly

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:5xt6, PDBe:5xt6, PDBj:5xt6
• PDBsum: 5xt6
• PubMed: 29235855
• UniProt: O32163|SUFU_BACSU Zinc-dependent sulfurtransferase SufU (Gene Name=sufU)