Structure of PDB 5xof Chain C Binding Site BS01

Receptor Information
>5xof Chain C (length=120) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLYGVTQPKHLSASMGGSVEIPFSFYYPWELATAPDVRISWRRGHFHGQS
FYSTRPPSIHKDYVNRLFLNWTEGQKSGFLRISNLQKQDQSVYFCRVELD
TRSSGRQQWQSIEGTKLSIT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5xof Structural and thermodynamic analyses reveal critical features of glycopeptide recognition by the human PILR alpha immune cell receptor.
Resolution1.963 Å
Binding residue
(original residue number in PDB)
R73 Q118 Q120
Binding residue
(residue number reindexed from 1)
R43 Q88 Q90
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5xof, PDBe:5xof, PDBj:5xof
PDBsum5xof
PubMed29046357
UniProtQ9UKJ1|PILRA_HUMAN Paired immunoglobulin-like type 2 receptor alpha (Gene Name=PILRA)

[Back to BioLiP]