Structure of PDB 5wy2 Chain C Binding Site BS01

Receptor Information
>5wy2 Chain C (length=149) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DPSLQIDIPDALSERDKVKFTVHTKTTLSTFQSPEFSVTRQHEDFVWLHD
TLTETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQE
LEAEYLAVFKKTVSTHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSVRR
Ligand information
>5wy2 Chain D (length=21) Species: 813 (Chlamydia trachomatis) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GPAVQFFKGKNGSADQVILVT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5wy2 Structural and functional insights into sorting nexin 5/6 interaction with bacterial effector IncE.
Resolution1.9 Å
Binding residue
(original residue number in PDB)
I35 P36 D37 A38 L39 S40 M106 Y132 L133 F136 K137 E144
Binding residue
(residue number reindexed from 1)
I8 P9 D10 A11 L12 S13 M79 Y105 L106 F109 K110 E117
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0035091 phosphatidylinositol binding

View graph for
Molecular Function
External links
PDB RCSB:5wy2, PDBe:5wy2, PDBj:5wy2
PDBsum5wy2
PubMed29263922
UniProtQ9Y5X3|SNX5_HUMAN Sorting nexin-5 (Gene Name=SNX5)

[Back to BioLiP]