Structure of PDB 5wby Chain C Binding Site BS01

Receptor Information
>5wby Chain C (length=317) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEVTPDRSMI
AAAGYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDC
TARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDL
KTDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEV
TQLIPKTKIPAHTRYALQCRFSPDSTLLATCSADQTCKIWRTSNFSLMTE
LSIKSGNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWCVETGEIKRE
YGGHQKAVVCLAFNDSV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5wby Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		Q164 L165 I166 P167 Y195 P212 K213 T214
Binding residue
(residue number reindexed from 1)		Q157 L158 I159 P160 Y188 P205 K206 T207
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0043539 protein serine/threonine kinase activator activity
Biological Process
GO:0006974 DNA damage response
GO:0007010 cytoskeleton organization
GO:0010507 negative regulation of autophagy
GO:0030307 positive regulation of cell growth
GO:0030838 positive regulation of actin filament polymerization
GO:0031669 cellular response to nutrient levels
GO:0031929 TOR signaling
GO:0032008 positive regulation of TOR signaling
GO:0032956 regulation of actin cytoskeleton organization
GO:0038202 TORC1 signaling
GO:0043066 negative regulation of apoptotic process
GO:0045821 positive regulation of glycolytic process
GO:0046889 positive regulation of lipid biosynthetic process
GO:0050731 positive regulation of peptidyl-tyrosine phosphorylation
GO:0071456 cellular response to hypoxia
GO:0071470 cellular response to osmotic stress
GO:1905857 positive regulation of pentose-phosphate shunt
Cellular Component
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005764 lysosome
GO:0005765 lysosomal membrane
GO:0005829 cytosol
GO:0016020 membrane
GO:0031931 TORC1 complex
GO:0031932 TORC2 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5wby, PDBe:5wby, PDBj:5wby
PDBsum5wby
PubMed29236692
UniProtQ9BVC4|LST8_HUMAN Target of rapamycin complex subunit LST8 (Gene Name=MLST8)

[Back to BioLiP]