Structure of PDB 5w9s Chain C Binding Site BS01

Receptor Information

>5w9s Chain C (length=44) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KKRKRCGMCAPCRRRINCEQCSSCRNRKTGHQICKFRKCEELKK

Ligand information

>5w9s Chain A (length=12) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gccaacgttggc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5w9s DNA Sequence Recognition of Human CXXC Domains and Their Structural Determinants.
Resolution	2.1 Å
Binding residue (original residue number in PDB)	K259 R260 H288 Q289 K295 L299
Binding residue (residue number reindexed from 1)	K2 R3 H31 Q32 K38 L42
Binding affinity	PDBbind-CN: Kd=0.1uM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0008270	zinc ion binding

View graph for
Molecular Function

External links

PDB	RCSB:5w9s, PDBe:5w9s, PDBj:5w9s
PDBsum	5w9s
PubMed	29276034
UniProt	Q7LFL8\|CXXC5_HUMAN CXXC-type zinc finger protein 5 (Gene Name=CXXC5)

[Back to BioLiP]