Structure of PDB 5w2m Chain C Binding Site BS01

Receptor Information
>5w2m Chain C (length=184) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NPMEAMYPHIFYFHFKNLRKAYGRNESWLCFTMEVVKHHSPVSWKRGVFR
NQVDPETHCHAERCFLSWFCDDILSPNTNYEVTWYTSWSPCPECAGEVAE
FLARHSNVNLTIFTARLYYFWDTDYQEGLRSLSQEGASVEIMGYKDFKYC
WENFVYNDDEPFKPWKGLKYNFLFLDSKLQEILE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5w2m Molecular Interactions of a DNA Modifying Enzyme APOBEC3F Catalytic Domain with a Single-Stranded DNA.
Resolution3.7 Å
Binding residue
(original residue number in PDB)		Y333 P353 W354 K355 G356 K358 Y359
Binding residue
(residue number reindexed from 1)		Y144 P164 W165 K166 G167 K169 Y170
Binding affinityPDBbind-CN: Kd=6.36uM
Enzymatic activity
Enzyme Commision number 3.5.4.38: single-stranded DNA cytosine deaminase.
Gene Ontology
Molecular Function
GO:0003824 catalytic activity
GO:0008270 zinc ion binding
GO:0016787 hydrolase activity

View graph for
Molecular Function
External links
PDB RCSB:5w2m, PDBe:5w2m, PDBj:5w2m
PDBsum5w2m
PubMed29191651
UniProtQ8IUX4|ABC3F_HUMAN DNA dC->dU-editing enzyme APOBEC-3F (Gene Name=APOBEC3F)

[Back to BioLiP]