Structure of PDB 5vm9 Chain C Binding Site BS01

Receptor Information
>5vm9 Chain C (length=785) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LMVPRRPGYGTMGKPIKLLANCFQVEIPKIDVYLYEVDIKPDKCPRRVNR
EVVDSMVQHFKVTIFGDRPVYDGKRSLYTANPLPVATTGVDLDVTFKVSI
KFVSRVSWHLLHEVLTGRTLPVHAVDVVLRHLPSMKYTPVGRSFFSAPEG
YDHPLGGGREVWFGFHQSVRPAMWKMMLNIDVSATAFYKAQPVIQFMCEV
LDIHNPRPLTDSHRVKFTKEIKGLKVEVTHCRKYRVCNVTRRPASHQTFP
LQTVERTVAQYFREKYTLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQ
RCIKKLTDNQTSTMIKATARSAPDRQEEISRLVRSANYETDPFVQEFQFK
VRDEMAHVTGRVLPAPMLQYGGRNRTVATPSHGVWDMRGKQFHTGVEIKM
WAIACFATQRQCREEILKGFTDQLRKISKDAGMPIQGQPCFCKYAQGADS
VEPMFRHLKNTYSGLQLIIVILPGKTPVYAEVKRVGDTLLGMATQCVQVK
NVIKTSPQTLSNLCLKINVKLGGINNILVPHQRPSVFQQPVIFLGADVTH
PPAGKPSIAAVVGSMDAHPSRYCATVRVQRPRQEIIQDLASMVRELLIQF
YKSTRFKPTRIIFYRDGVSEGQFRQVLYYELLAIREACISLEKDQPGITY
IVVQKRHHTRLFCADRTERVGRSGNIPAGTTVDTDITHPYEFDFYLCSHA
GIQGTSRPSHYHVLWDDNCFTADELQLLTYQLCHTYVRCTRSVSIPAPAY
YAHLVAFRARYHLDPQALAKAVQIHQDTLRTMYFA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5vm9 Human Argonaute3 has slicer activity.
Resolution3.28 Å
Binding residue
(original residue number in PDB)		P59 T223 R278 Y280 F295 Y312 F313 Y317 V331 T338 Y339 R352 I366 T369 A370 L523 G525 Y530 Q546 C547 V548 Q549 N552 Q559 T560 N563 L564 K567 H754 I757 Q758 T760 S761 R762 Y791 R793 C794 R796 S799 Y805
Binding residue
(residue number reindexed from 1)		P45 T185 R232 Y234 F249 Y261 F262 Y266 V280 T287 Y288 R301 I315 T318 A319 L472 G474 Y479 Q495 C496 V497 Q498 N501 Q508 T509 N512 L513 K516 H699 I702 Q703 T705 S706 R707 Y736 R738 C739 R741 S744 Y750
Enzymatic activity
Enzyme Commision number 3.1.26.n2: argonaute-2.
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003725 double-stranded RNA binding
GO:0003727 single-stranded RNA binding
GO:0004519 endonuclease activity
GO:0004521 RNA endonuclease activity
GO:0005515 protein binding
GO:0035198 miRNA binding
GO:0046872 metal ion binding
GO:0061980 regulatory RNA binding
GO:0090624 endoribonuclease activity, cleaving miRNA-paired mRNA
Biological Process
GO:0006402 mRNA catabolic process
GO:0006417 regulation of translation
GO:0010501 RNA secondary structure unwinding
GO:0010628 positive regulation of gene expression
GO:0031047 regulatory ncRNA-mediated gene silencing
GO:0031054 pre-miRNA processing
GO:0035194 regulatory ncRNA-mediated post-transcriptional gene silencing
GO:0035196 miRNA processing
GO:0035278 miRNA-mediated gene silencing by inhibition of translation
GO:0035279 miRNA-mediated gene silencing by mRNA destabilization
GO:0070922 RISC complex assembly
GO:0072091 regulation of stem cell proliferation
GO:0090625 siRNA-mediated gene silencing by mRNA destabilization
GO:1901224 positive regulation of non-canonical NF-kappaB signal transduction
Cellular Component
GO:0000794 condensed nuclear chromosome
GO:0000932 P-body
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0016020 membrane
GO:0016442 RISC complex
GO:0036464 cytoplasmic ribonucleoprotein granule
GO:0043232 intracellular non-membrane-bounded organelle
GO:0070578 RISC-loading complex
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5vm9, PDBe:5vm9, PDBj:5vm9
PDBsum5vm9
PubMed29040713
UniProtQ9H9G7|AGO3_HUMAN Protein argonaute-3 (Gene Name=AGO3)

[Back to BioLiP]