Structure of PDB 5vfx Chain C Binding Site BS01

Receptor Information
>5vfx Chain C (length=100) Species: 1502 (Clostridium perfringens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KDLNLYAKELVDVVNYLMKKNQLVFSRNNKFIYVNTETIKSMLEKRNYDT
VDGKLYLWRELEWIECAEDRFNKRIKIDGENMYAVVIKYSSYSILKRLYL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5vfx Crystal structure of TcpK in complex with oriT DNA of the antibiotic resistance plasmid pCW3.
Resolution2.81 Å
Binding residue
(original residue number in PDB)		K41 R60 D70 R71 F72 N73 R75 Y84
Binding residue
(residue number reindexed from 1)		K40 R59 D69 R70 F71 N72 R74 Y83
Binding affinityPDBbind-CN: Kd=360nM
Enzymatic activity
Enzyme Commision number ?
External links