Structure of PDB 5vc9 Chain C Binding Site BS01

Receptor Information

>5vc9 Chain C (length=46) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KKRKRCGVCVPCKRLINCGVCSSCRNRKTGHQICKFRKCEELKKKP

Ligand information

>5vc9 Chain A (length=12) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gccaacgttggc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5vc9 DNA Sequence Recognition of Human CXXC Domains and Their Structural Determinants.
Resolution	2.1 Å
Binding residue (original residue number in PDB)	R136 H164 R170 K171
Binding residue (residue number reindexed from 1)	R3 H31 R37 K38
Binding affinity	PDBbind-CN: Kd=0.16uM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0008270	zinc ion binding

View graph for
Molecular Function

External links

PDB	RCSB:5vc9, PDBe:5vc9, PDBj:5vc9
PDBsum	5vc9
PubMed	29276034
UniProt	Q9H2H0\|CXXC4_HUMAN CXXC-type zinc finger protein 4 (Gene Name=CXXC4)

[Back to BioLiP]