Structure of PDB 5vax Chain C Binding Site BS01

Receptor Information
>5vax Chain C (length=136) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DNREIVMKYIHYKLSQRGYEWDSEVVHLTLRQAGDDFSRRYRRDFAEMSS
QLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMS
PLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYG
Ligand information
>5vax Chain G (length=23) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GTMENLSRRLKVTGDLFDIMSGQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5vax Bcl-2 complex with Beclin 1 pT108 BH3 domain
Resolution2.0 Å
Binding residue
(original residue number in PDB)		A100 D103 F104 R107 Y108 F112 H120 R129 T132 E136 L137 D140 N143 G145 R146 F153 Y202
Binding residue
(residue number reindexed from 1)		A33 D36 F37 R40 Y41 F45 H53 R62 T65 E69 L70 D73 N76 G78 R79 F86 Y135
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:5vax, PDBe:5vax, PDBj:5vax
PDBsum5vax
PubMed
UniProtP10415|BCL2_HUMAN Apoptosis regulator Bcl-2 (Gene Name=BCL2)

[Back to BioLiP]